<?xml version = "1.0" encoding = "UTF-8"?>
<serviceDescriptions  xmlns="pd" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:schemaLocation="pd /C:/Documents and Settings/ytanoh/My Documents/taverna-1.4-old/plugins/pedro/services/model/common.xsd">
	<serviceDescription >
		<serviceName>TFmodeller</serviceName>
        <organisation> 
            <organisationName>Center for Genomic Sciences</organisationName>
            <organisationDescriptionText>http://www.ccg.unam.mx/</organisationDescriptionText>
        </organisation>
		<locationURL>http://maya.ccg.unam.mx:8080/axis/TFmodellerService.jws</locationURL>
		<interfaceWSDL>http://maya.ccg.unam.mx:8080/axis/TFmodellerService.jws?WSDL</interfaceWSDL>
		<serviceDescriptionText>Scans a protein sequence P against a library of protein-DNA complexes and builds comparative models of P if good templates are found. These models are used to get an idea of the P-DNA interface, its evolution and the putative recognised DNA sequences.
Detailed info about this service can be found at:
http://maya.ccg.unam.mx/~tfmodell/tutorial.html</serviceDescriptionText>
		<operations >
			<serviceOperation >
				<operationName>TFmodeller</operationName>
				<operationSpec>&lt;s:arbitrarywsdl xmlns:s=&quot;http://org.embl.ebi.escience/xscufl/0.1alpha&quot;&gt;&lt;s:wsdl&gt;http://maya.ccg.unam.mx:8080/axis/TFmodellerService.jws?WSDL&lt;/s:wsdl&gt;&lt;s:operation&gt;TFmodeller&lt;/s:operation&gt;&lt;/s:arbitrarywsdl&gt;</operationSpec>
				<operationDescriptionText>Scans a protein sequence P against a library of protein-DNA complexes and builds comparative models of P if good templates are found. These models are used to get an idea of the P-DNA interface, its evolution and the putative recognised DNA sequences.
Detailed info about this service can be found at:
http://maya.ccg.unam.mx/~tfmodell/tutorial.html</operationDescriptionText>
				<operationInputs >
					<parameter >
						<parameterName>proteinFASTAsequence</parameterName>
						<messageName>TFmodellerRequest</messageName>
						<parameterDescription>One or more proteins sequence in fasta format known or suspected to bind to DNA. For example, the FNR transcription factor in E.coli:

&gt;P0A9E5|FNR_ECOLI Fumarate and nitrate reduction regulato...
MIPEKRIIRRIQSGGCAIHCQDCSISQLCIPFTLNEHELDQLDNIIERKKPIQKGQTLFKAGDELKSLYAIRSGTIKSYTITEQGDEQITGFHLAGDLVGFDAIGSGHHPSFAQALETSMVCEIPFETLDDLSGKMPNLRQQMMRLMSGEIKGDQDMILLLSKKNAEERLAAFIYNLSRRFAQRGFSPREFRLTMTRGDIGNYLGLTVETISRLLGRFQKSGMLAVKGKYITIENNDALAQLAGHTRNVA
</parameterDescription>
						<isConfigurationParameter>false</isConfigurationParameter>
						<semanticType>http://www.mygrid.org.uk/ontology#protein_sequence</semanticType>
						<parameterFormat>http://www.mygrid.org.uk/ontology#fasta_format</parameterFormat>
						<transportDataType>String</transportDataType>
					</parameter>

				</operationInputs>

				<operationOutputs >
					<parameter >
						<parameterName>TFmodellerReturn</parameterName>
						<messageName>TFmodellerResponse</messageName>
						<parameterDescription>Returns a matrix of homologous interface contacts, that shows a multiple interface alignment of the user&apos;s input sequence to one or more structurally related protein-DNA complexes. </parameterDescription>
						<isConfigurationParameter>false</isConfigurationParameter>
						<semanticType>http://www.mygrid.org.uk/ontology#pairwise_sequence_alignment_report</semanticType>
					</parameter>

				</operationOutputs>

				<operationTask>http://www.mygrid.org.uk/ontology#pairwise_local_aligning</operationTask>
				<operationMethod>http://www.mygrid.org.uk/ontology#BLAST_Basic_Local_Alignment_Search_Tool</operationMethod>
			</serviceOperation>

		</operations>

		<serviceType>WSDL service</serviceType>
	</serviceDescription>

</serviceDescriptions>
